DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34323 and Slc4a1ap

DIOPT Version :10

Sequence 1:NP_001096962.1 Gene:CG34323 / 5740207 FlyBaseID:FBgn0085352 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001334257.1 Gene:Slc4a1ap / 20534 MGIID:1196608 Length:744 Species:Mus musculus


Alignment Length:119 Identity:32/119 - (26%)
Similarity:54/119 - (45%) Gaps:20/119 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTGDRINLNEGIQILGRHSSCTWVLKYDYMSRYHALIHVNQGD-----------IFIKEMETNNG 62
            :.|.|...:......||.:||...|::..:|||||::.....|           .::.::.:.:|
Mouse   123 ILGTRTLKDTSCCFFGRLASCDICLEHPSVSRYHAVLQHRGADPSGDSEGHEQGFYLYDLGSTHG 187

  Fly    63 IFLNYWPTRI-GSSWCEVNVGDVLYFG------VQLGIEHDGEIPNTFGIFTVK 109
            .|||  .||| ..::|.|:||.|:.||      :..|.|.|.|..:...:..:|
Mouse   188 TFLN--KTRIPPRTYCRVHVGHVMRFGGSTRLFILQGPEEDREAESELTVTQLK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34323NP_001096962.1 FHA 5..88 CDD:441322 25/90 (28%)
Slc4a1apNP_001334257.1 FHA_Kanadaptin 112..222 CDD:438729 27/100 (27%)
DSRM_Kanadaptin 309..391 CDD:380685
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.