DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34261 and POA1

DIOPT Version :9

Sequence 1:NP_001097656.1 Gene:CG34261 / 5740205 FlyBaseID:FBgn0085290 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_009578.1 Gene:POA1 / 852310 SGDID:S000000226 Length:177 Species:Saccharomyces cerevisiae


Alignment Length:194 Identity:47/194 - (24%)
Similarity:74/194 - (38%) Gaps:71/194 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGLTYREINGDLFKCQRDYS-----MCHCVAADLRMGRGIA--------------VKFRNKFGQ 46
            ||.:||  :.|::.| .:.|:     .|:|..:   .|.|||              |:...|:|.
Yeast     1 MSNITY--VKGNILK-PKSYARILIHSCNCNGS---WGGGIAYQLALRYPKAEKDYVEVCEKYGS 59

  Fly    47 LLNLQRQNVQPGGVAVL----QDQQRFIYYLITKKSSWGKPTYELLQSSL----IAMRK------ 97
              ||.       |..:|    ::....|..|.|  ||:|..::...||.|    :|:.|      
Yeast    60 --NLL-------GKCILLPSYENSDLLICCLFT--SSFGGSSHGEKQSILNYTKLALDKLKTFRE 113

  Fly    98 --------------HMISH-QVP----KLAMPRIGCGLDGLNWPKVKEIICQVFQADSVELVVY 142
                          ::..| :.|    ||.||:|..|:.|:.| |..|.:.:.|..| :...||
Yeast   114 AKDKTRTSEDSIGDYLNGHIKYPIGEYKLEMPQINSGIFGVPW-KETERVLEEFSGD-MSFTVY 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34261NP_001097656.1 Macro_Poa1p_like 7..133 CDD:239230 39/177 (22%)
POA1NP_009578.1 YmdB 1..174 CDD:225021 45/191 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12521
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.