DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34261 and oard1

DIOPT Version :9

Sequence 1:NP_001097656.1 Gene:CG34261 / 5740205 FlyBaseID:FBgn0085290 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001018591.1 Gene:oard1 / 553793 ZFINID:ZDB-GENE-050522-480 Length:155 Species:Danio rerio


Alignment Length:141 Identity:63/141 - (44%)
Similarity:90/141 - (63%) Gaps:0/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGLTYREINGDLFKCQRDYSMCHCVAADLRMGRGIAVKFRNKFGQLLNLQRQNVQPGGVAVLQDQ 66
            ||.......||||.|....::.||::.|.|||.||||.|:..|..:..|:.|..|||..|||:..
Zfish    13 SGWQLLHRRGDLFTCPPTDALAHCISEDCRMGAGIAVLFKKHFKGVEELKAQKRQPGQCAVLERS 77

  Fly    67 QRFIYYLITKKSSWGKPTYELLQSSLIAMRKHMISHQVPKLAMPRIGCGLDGLNWPKVKEIICQV 131
            .||:|||:|||..:.|||.|.|:.||::|::|.:::.|.:::|||||||||.::|..|..||.:|
Zfish    78 GRFVYYLVTKKYYYQKPTSESLRKSLMSMKEHCLANGVNRVSMPRIGCGLDKMHWENVSSIITEV 142

  Fly   132 FQADSVELVVY 142
            ||...:.:.||
Zfish   143 FQDTKISITVY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34261NP_001097656.1 Macro_Poa1p_like 7..133 CDD:239230 57/125 (46%)
oard1NP_001018591.1 Macro_Poa1p_like 16..146 CDD:239230 59/129 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579241
Domainoid 1 1.000 103 1.000 Domainoid score I6732
eggNOG 1 0.900 - - E1_29TCN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4610
OMA 1 1.010 - - QHG47785
OrthoDB 1 1.010 - - D1416296at2759
OrthoFinder 1 1.000 - - FOG0006886
OrthoInspector 1 1.000 - - otm25981
orthoMCL 1 0.900 - - OOG6_108279
Panther 1 1.100 - - LDO PTHR12521
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5787
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.