DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34261 and Oard1

DIOPT Version :9

Sequence 1:NP_001097656.1 Gene:CG34261 / 5740205 FlyBaseID:FBgn0085290 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001128068.1 Gene:Oard1 / 367214 RGDID:1308299 Length:158 Species:Rattus norvegicus


Alignment Length:113 Identity:35/113 - (30%)
Similarity:51/113 - (45%) Gaps:22/113 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGLTYREINGDLFKCQRDYSMCHCVAADLRMGRGIAVKFRNKFGQLLNLQRQNVQPGGVAVLQDQ 66
            |.:||  :.||||.|.:..|:.||::.|.|||.||||.|:.:|             |||..|..|
  Rat    12 SRITY--VKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKRF-------------GGVQELLSQ 61

  Fly    67 QRFIYYLITKKSSWGKPTYELLQSSLIAMRKHM---ISHQVPKLAMPR 111
            :....:::..    ||...:.|:..|......:   .|.||..|..|:
  Rat    62 RLDAVWIVCS----GKMYLQFLKRCLSQQTSRLPCTHSEQVKMLGEPK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34261NP_001097656.1 Macro_Poa1p_like 7..133 CDD:239230 32/108 (30%)
Oard1NP_001128068.1 Macro 14..>62 CDD:294024 24/62 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339508
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29TCN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416296at2759
OrthoFinder 1 1.000 - - FOG0006886
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108279
Panther 1 1.100 - - LDO PTHR12521
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5787
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.