DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34261 and OARD1

DIOPT Version :9

Sequence 1:NP_001097656.1 Gene:CG34261 / 5740205 FlyBaseID:FBgn0085290 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001316613.1 Gene:OARD1 / 221443 HGNCID:21257 Length:152 Species:Homo sapiens


Alignment Length:141 Identity:71/141 - (50%)
Similarity:93/141 - (65%) Gaps:2/141 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGLTYREINGDLFKCQRDYSMCHCVAADLRMGRGIAVKFRNKFGQLLNLQRQNVQPGGVAVLQDQ 66
            |.:||  :.||||.|.:..|:.||::.|.|||.||||.|:.|||.:..|..|..:.|.||||:..
Human    12 SRITY--VKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRD 74

  Fly    67 QRFIYYLITKKSSWGKPTYELLQSSLIAMRKHMISHQVPKLAMPRIGCGLDGLNWPKVKEIICQV 131
            .|:||||||||.:..|||||.||.||.||:.|.:.:.|..|:|||||||||.|.|..|..:|.:|
Human    75 GRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEV 139

  Fly   132 FQADSVELVVY 142
            |:|..:::.||
Human   140 FEATDIKITVY 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34261NP_001097656.1 Macro_Poa1p_like 7..133 CDD:239230 64/125 (51%)
OARD1NP_001316613.1 Macro_Poa1p-like 13..143 CDD:394873 67/131 (51%)
Substrate binding. /evidence=ECO:0000269|PubMed:21849506, ECO:0000269|PubMed:23481255 119..125 5/5 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145800
Domainoid 1 1.000 119 1.000 Domainoid score I5805
eggNOG 1 0.900 - - E1_29TCN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47785
OrthoDB 1 1.010 - - D1416296at2759
OrthoFinder 1 1.000 - - FOG0006886
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108279
Panther 1 1.100 - - LDO PTHR12521
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5787
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.720

Return to query results.
Submit another query.