DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clos and Tspear

DIOPT Version :9

Sequence 1:NP_001097246.3 Gene:clos / 5740204 FlyBaseID:FBgn0261016 Length:1836 Species:Drosophila melanogaster
Sequence 2:XP_038955104.1 Gene:Tspear / 365546 RGDID:1563108 Length:622 Species:Rattus norvegicus


Alignment Length:429 Identity:95/429 - (22%)
Similarity:162/429 - (37%) Gaps:143/429 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LDICILQLPTV-KYATALHKNAAGVRHFAVYTWRPAE-QDYQLLVELETPKAVALDCLAFAGRGY 137
            |.|.:..:|.| .:|.|.::.|..    |:|.|...: ..||   .:.|.:|.:........:.:
  Rat   281 LGIEVFNIPGVGLFAAAANRKARS----AIYKWSDGKFVSYQ---NIATHQAQSWRHFTIGKKIF 338

  Fly   138 VAVSYNLTEPVSQAREGSPIYEISPETGIRTVQYFSGTHLRGMYLRISSQELTLLHAFESNAQCP 202
            :||: |. .|..:.:|.|.||:.||    |.:::                  ||           
  Rat   339 LAVA-NF-GPNERGQEFSVIYKWSP----RKLKF------------------TL----------- 368

  Fly   203 YFKWMGKSFQRLGAIHCSKARRMEAFGIDYTDYVAVANYADAEGRTATHSEIFRWDAKSQRFQLF 267
                    :||: |.|  .||..|||.:|...::.|||:.:.:... ..|.::||:..||.|:..
  Rat   369 --------YQRI-ATH--SARDWEAFEVDGEHFLVVANHREGDNHN-IDSVVYRWNPSSQLFEAN 421

  Fly   268 QRLRSNGAVDVKYFSLPVNEVSRRHFLILGNTIGGTGAEVGDADTVIYVFEKGQFVPYQR-LSFY 331
            |.:.::||.|.::|:     |....||::.||..||..:|   .:.:|::..|.|..:|. |:|.
  Rat   422 QSIATSGAYDWEFFT-----VGPYSFLVVANTFNGTSTQV---HSHLYIWLVGAFQLFQSFLTFG 478

  Fly   332 ALERVLPVQHSISEKFLLLVA-CNKQDVK-------------IYNLN------------------ 364
            |.:  ..|.| |.|:..|.|| .:..||:             ||.||                  
  Rat   479 AAD--WEVFH-IGERIFLAVANSHSYDVQMQAQNDTYILSSVIYELNVTAQTFVKFQDIPTCSAL 540

  Fly   365 DWRFEESKVQFTEGALSRGVARMRSYEEGDQSYLVIANENMAANETNIFQPLYKQDEHANILRQQ 429
            ||.|                     :..|:..:||:|| :...|..::...:|:...:...:...
  Rat   541 DWEF---------------------FSVGEDHFLVVAN-SFDGNTFSVNSIIYRWQGYEGFVAVH 583

  Fly   430 II------DW---------------AREQRKRLEQMNLD 447
            .:      ||               |:|...|:.::..|
  Rat   584 KLPTFGCRDWEAFNTTAGSYLIYSSAKEPLSRVLKLRTD 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
closNP_001097246.3 EPTP 263..315 CDD:281697 14/51 (27%)
TspearXP_038955104.1 LamG <23..175 CDD:419873
EPTP 313..358 CDD:397689 11/49 (22%)
EPTP 365..410 CDD:397689 16/85 (19%)
EPTP 418..454 CDD:397689 13/40 (33%)
EPTP 468..520 CDD:397689 15/54 (28%)
EPTP 528..572 CDD:397689 9/65 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto97671
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15261
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.