DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clos and tspear

DIOPT Version :9

Sequence 1:NP_001097246.3 Gene:clos / 5740204 FlyBaseID:FBgn0261016 Length:1836 Species:Drosophila melanogaster
Sequence 2:XP_012826895.2 Gene:tspear / 100492500 XenbaseID:XB-GENE-6050978 Length:683 Species:Xenopus tropicalis


Alignment Length:336 Identity:82/336 - (24%)
Similarity:134/336 - (39%) Gaps:73/336 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 QDYQLLVELETPKAVALDCLAFAGRGYVAVSYNL-TEPVSQAREGSPIYEISPETGIRTVQYFSG 174
            :|||.|..:.  :.:.|:.......|:.||..|. |:|      ||.:|..:.|..: ..|||:.
 Frog   328 EDYQNLATIS--ETMGLEIFLIPDVGHFAVMANKNTQP------GSVLYRWTDEKFV-VHQYFTT 383

  Fly   175 THLR-GMYLRISSQELTLLHAFESN----AQCPYFKW--MGKSFQRLGAIHCSKARRMEAFGIDY 232
            ...: ..|..|..:....|..||.|    .....:||  :...|.....|....||..|||.||.
 Frog   384 YQAQTWKYFTIGKRIFLALANFERNDDGTEHSVIYKWNPVKLKFLPYQKIRTYSARDWEAFHIDG 448

  Fly   233 TDYVAVANYADAEGRTATHSEIFRWDAKSQRFQLFQRLRSNGAVDVKYFSL-PVNEVSRRHFLIL 296
            .:::||||:.:..... .:|.|::|::.|..|::.|.:.::||.|.::||: |.|      ||::
 Frog   449 ENFLAVANHREGNNHN-INSVIYKWNSSSGLFEVNQTIPTSGAYDWEFFSIGPYN------FLVV 506

  Fly   297 GNTIGGTGAEVGDADTVIYVFEKGQFVPYQRLSFYALERVLPVQHSISEKFLLLVACNKQDVKIY 361
            .||..||...:   .:.||:.....|.|:                              |.:..:
 Frog   507 ANTFNGTSTNI---QSTIYIRLGNSFRPF------------------------------QSMMTF 538

  Fly   362 NLNDWRFEESKVQFTEGALSRGVARMRSYEEGDQS----YLVIANENMAANETNIFQPLYKQDEH 422
            ..:||.|...:.:|     ...||...||:.|.|.    |::    |....|.||....:  ::.
 Frog   539 GASDWEFFRIQDRF-----FLAVANSHSYDIGTQGPKNLYVI----NSTIYELNITGQQF--EKF 592

  Fly   423 ANILRQQIIDW 433
            .:||....:||
 Frog   593 QDILTLSAVDW 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
closNP_001097246.3 EPTP 263..315 CDD:281697 15/52 (29%)
tspearXP_012826895.2 LamG 35..225 CDD:419873
EPTP 374..419 CDD:397689 9/45 (20%)
EPTP 426..471 CDD:397689 15/45 (33%)
EPTP 479..515 CDD:397689 15/41 (37%)
EPTP 528..581 CDD:397689 15/91 (16%)
EPTP 588..633 CDD:397689 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto104357
Panther 1 1.100 - - LDO PTHR15261
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4919
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.