DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-11 and AT1G15120

DIOPT Version :9

Sequence 1:NP_001104407.2 Gene:UQCR-11 / 5740185 FlyBaseID:FBgn0260008 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001154342.1 Gene:AT1G15120 / 838075 AraportID:AT1G15120 Length:166 Species:Arabidopsis thaliana


Alignment Length:79 Identity:27/79 - (34%)
Similarity:39/79 - (49%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FSLPAVRADDEEDLVDPQAVLREKCQAKGHIESLYNKYQECNDRVNGRSKTTETCIEELFDYVAE 71
            |.|....||||  :|||:..|.|.|:.| .::.|. :||.|..|:.|.....:.|..:.|||...
plant    62 FQLTFNMADDE--VVDPKKYLEESCKPK-CVKPLL-EYQACVKRIQGDDSGHKHCTGQYFDYWQC 122

  Fly    72 LDHCVSHSLFTKLK 85
            :|.|..    |::|
plant   123 IDKCFD----TEMK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-11NP_001104407.2 UCR_hinge 22..84 CDD:280480 19/61 (31%)
AT1G15120NP_001154342.1 UCR_hinge 75..126 CDD:367034 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I4736
eggNOG 1 0.900 - - E1_KOG4763
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I2651
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2574
orthoMCL 1 0.900 - - OOG6_102683
Panther 1 1.100 - - O PTHR15336
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.