DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-11 and UQCRH

DIOPT Version :9

Sequence 1:NP_001104407.2 Gene:UQCR-11 / 5740185 FlyBaseID:FBgn0260008 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_005995.2 Gene:UQCRH / 7388 HGNCID:12590 Length:91 Species:Homo sapiens


Alignment Length:76 Identity:32/76 - (42%)
Similarity:46/76 - (60%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PAVRADDEEDLVDPQAVLREKCQAKGHIESLYNKYQECNDRVNGRSKTTETCIEELFDYVAELDH 74
            |....::||:||||...:||:|:..........:.:.|::||:.||.|.|.|.|||||::...||
Human    16 PEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDH 80

  Fly    75 CVSHSLFTKLK 85
            ||:|.||..||
Human    81 CVAHKLFNNLK 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-11NP_001104407.2 UCR_hinge 22..84 CDD:280480 25/61 (41%)
UQCRHNP_005995.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 6/13 (46%)
UCR_hinge 28..91 CDD:367034 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159186
Domainoid 1 1.000 64 1.000 Domainoid score I10110
eggNOG 1 0.900 - - E1_KOG4763
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5277
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52039
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005545
OrthoInspector 1 1.000 - - mtm8595
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15336
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4498
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.