DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-11 and uqcrh

DIOPT Version :9

Sequence 1:NP_001104407.2 Gene:UQCR-11 / 5740185 FlyBaseID:FBgn0260008 Length:85 Species:Drosophila melanogaster
Sequence 2:XP_031756806.1 Gene:uqcrh / 100492979 XenbaseID:XB-GENE-963373 Length:91 Species:Xenopus tropicalis


Alignment Length:71 Identity:31/71 - (43%)
Similarity:41/71 - (57%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DDEEDLVDPQAVLREKCQAKGHIESLYNKYQECNDRVNGRSKTTETCIEELFDYVAELDHCVSHS 79
            ::||:||||...:||.|:............:.|..|||.||.|.|.|.|||||::...||||:|.
 Frog    21 EEEEELVDPLTTVREHCEQSEKCVKAREILELCETRVNSRSHTEEECTEELFDFLHARDHCVAHK 85

  Fly    80 LFTKLK 85
            :|..||
 Frog    86 VFKNLK 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-11NP_001104407.2 UCR_hinge 22..84 CDD:280480 25/61 (41%)
uqcrhXP_031756806.1 UCR_hinge 28..91 CDD:396756 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10281
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5140
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005545
OrthoInspector 1 1.000 - - otm48302
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4498
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.