DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and Prss44

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:263 Identity:74/263 - (28%)
Similarity:126/263 - (47%) Gaps:66/263 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KETPWMAFIASPTKN-CSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHSVQSV 101
            ::.||...:....:: |.|:||:|.:|||.|.||:...:..||:|..|...:   |.|:..||.:
Mouse   121 RKWPWQVSLQVHKQHICGGSLISKWWVITAAHCVYGHLDYAVFMGDADLWSK---RPVRIPVQDI 182

  Fly   102 YTHKLYN-KQTFEHDIALLLLDDPVTFKMSIQPICI-------------WL---GEITNLNHLES 149
            ..|:.:: .:|..|||||:||..||.:.::|||:||             |:   |::     ||.
Mouse   183 IVHQDFSMMRTVVHDIALVLLAFPVNYSVNIQPVCIPEKSFLVQPGTLCWVTGWGKV-----LEQ 242

  Fly   150 NRWGLSEKMIFQRINTVKILKIKKC----RDSFG--ITLKKSQICAGF--QNGNICT-ETGSSLV 205
            .|    ...|.|.|. :.|::.:||    :|..|  .||.:.....|:  :.|:.|. ::|..||
Mouse   243 GR----SSRILQEIE-LNIIRHEKCNQILKDIMGNIFTLVQEGGVCGYNEKGGDACQGDSGGPLV 302

  Fly   206 KQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWIVG-------------VVLNVD 250
            .:.:   |.| ..:||.|:|:.  |       :|.::::|.|||:.             :||:|.
Mouse   303 CEFN---KTW-VQVGIVSWGLG--CGRIGYPGVYTEVSYYRDWIIKELSRASCWKLSGFLVLSVC 361

  Fly   251 VIL 253
            ::|
Mouse   362 LVL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 68/236 (29%)
Tryp_SPc 39..242 CDD:304450 68/236 (29%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 111..340 CDD:214473 68/237 (29%)
Tryp_SPc 112..340 CDD:238113 68/237 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.