DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and C1R

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens


Alignment Length:240 Identity:56/240 - (23%)
Similarity:98/240 - (40%) Gaps:56/240 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIASPTKNCSGTLINKQYVITTASCVFD-----QSEST--VFLGRFDNIPQNRNRYVKHSV 98
            ||..|.....:. .|.|:..::::|.|..::.     ||.::  ||||. .|: :...:...|.:
Human   490 PWQVFTNIHGRG-GGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGH-TNV-EELMKLGNHPI 551

  Fly    99 QSVYTHKLYNKQ---TFEHDIALLLLDDPVTFKMSIQPICI----------WLGEITNLNHLESN 150
            :.|..|..|.:.   .||.|||||.|::.||...::.|||:          .:|.::.       
Human   552 RRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSG------- 609

  Fly   151 RWGLSEKMIFQRINTVKI-----------LKIKKCRDSFGITLKKSQICAGFQN--GNICTETGS 202
             :|:.|:.|...:..|::           |:.|...|.|    .::..|||..:  .:.|.....
Human   610 -FGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVF----SQNMFCAGHPSLKQDACQGDSG 669

  Fly   203 SLVKQIHYSGKLWNTLIGIQSYGVSERC-----IYNKIAHYIDWI 242
            .:......:...| ...||.|:|:.  |     .|.|:.:|:|||
Human   670 GVFAVRDPNTDRW-VATGIVSWGIG--CSRGYGFYTKVLNYVDWI 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 54/238 (23%)
Tryp_SPc 39..242 CDD:304450 54/238 (23%)
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839
Sushi 323..385 CDD:306569
Sushi 390..461 CDD:306569
Tryp_SPc 477..711 CDD:214473 54/238 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.