DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and Prss56

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_006529921.1 Gene:Prss56 / 69453 MGIID:1916703 Length:605 Species:Mus musculus


Alignment Length:242 Identity:56/242 - (23%)
Similarity:91/242 - (37%) Gaps:66/242 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFI---ASPTKNCSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHSVQSVY 102
            ||:..:   ..|.  |.|.|:...:|:|.|.|....|...::.......||. .:..:..|..:.
Mouse   122 PWLVRLQLGGLPL--CGGVLVAASWVLTAAHCFAGASNELLWTVMLAEGPQG-EQAEEVQVNRIL 183

  Fly   103 THKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGE----------ITNLNHLESNRWGL--- 154
            .|..::.|||.:|:||:.|..||:.:...:|||:..|.          |..        ||.   
Mouse   184 PHPKFDPQTFHNDLALVQLWTPVSPEGPARPICLPQGSREPPAGTPCAIAG--------WGALFE 240

  Fly   155 ----SEKMIFQRINTVKILKIKKCRDSFGITLKKS-QICAGFQNGNI------------CTETGS 202
                ||.:   |...|.:|....|:...|..|:.| .:|||:..|.|            |:|.|.
Mouse   241 DGPESEAV---REARVPLLSADTCQKVLGPGLRPSTMLCAGYLAGGIDSCQGDSGGPLTCSEPGP 302

  Fly   203 SLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
                      :....|.|:.|:|  :.|       :|.::..:.||:
Mouse   303 ----------RPREVLFGVTSWG--DGCGEPGKPGVYTRVTVFKDWL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 55/240 (23%)
Tryp_SPc 39..242 CDD:304450 55/240 (23%)
Prss56XP_006529921.1 Tryp_SPc 109..336 CDD:214473 54/239 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.