DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and Prss55

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_008769022.1 Gene:Prss55 / 683415 RGDID:1586875 Length:321 Species:Rattus norvegicus


Alignment Length:240 Identity:62/240 - (25%)
Similarity:108/240 - (45%) Gaps:59/240 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETPWMAFIASPTKN-CSGTLINKQYVITTASCVFDQ----SESTVFLGRFD--NIPQNRNRYVKH 96
            |.||...|.....: |.|:::::.:::|.|.|.:.|    :|.||.:|..|  ..|      ::.
  Rat    45 EFPWQVSIQENDHHFCGGSILSEWWILTVAHCFYSQELSPTELTVRVGTNDLTTSP------MEL 103

  Fly    97 SVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI------------WLGEITNLNHLES 149
            .|.::..||.:.:.:.::|||||||.:|:||.....|||:            |:.          
  Rat   104 QVTNIIRHKDFKRHSMDNDIALLLLANPLTFNEQTVPICMPLQPTPPSWQECWVA---------- 158

  Fly   150 NRWGLSEKMIFQRINTVKILKI-------KKCRDSFGITLKKSQICAGFQNGNI--CT-ETGSSL 204
             .||.:.....:.:| :.::|:       |:|...|. :|..:.:||.:.|.:.  |. ::|..|
  Rat   159 -GWGTTNSADKESMN-MDLMKVPMRITDWKECLQLFP-SLTTNMLCASYGNESFDACQGDSGGPL 220

  Fly   205 VKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
            |......|:.:.  :||.|:|.|  |       ||..:|:||.||
  Rat   221 VCNQESDGRWYQ--VGIISWGKS--CGQKGSPGIYTVLANYILWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 60/238 (25%)
Tryp_SPc 39..242 CDD:304450 60/238 (25%)
Prss55XP_008769022.1 Tryp_SPc 35..264 CDD:238113 62/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.