DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and AgaP_AGAP011913

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_001689277.1 Gene:AgaP_AGAP011913 / 5667996 VectorBaseID:AGAP011913 Length:399 Species:Anopheles gambiae


Alignment Length:260 Identity:57/260 - (21%)
Similarity:104/260 - (40%) Gaps:46/260 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QGSAYFLDFECVNHKP------HQDVFKETPWMAFIASPTKN---CSGTLINKQYVITTASCVFD 72
            |.:|..|..:|..||.      ...:..|.|.||.:...:..   |..|::..::|:|.|.|:.|
Mosquito   141 QITALKLACDCGRHKTPTIVNGFPTLTNEYPMMAGLVDNSLAKVFCGSTIVTDRHVLTAAHCLLD 205

  Fly    73 Q--SESTVFLGRFDNIPQNRNRYVK-HSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPI 134
            :  :.::|.:|..|....:...|.. :.:.:...|..||..:..:||||:...:.:.|...:..:
Mosquito   206 RTVTGTSVLVGDQDISTGSDTPYSSLYRISTFTQHPSYNPTSKTNDIALVQTFNTIVFNPGVGRV 270

  Fly   135 CI----WLGEITNLNHLESNRWGL------SEKMIFQRINTVKILKIKKCRDSFGITLKKSQICA 189
            |:    ......|: .|.:..||.      |...:.|  .|:.::....|......|:..||:|.
Mosquito   271 CLPFFFSTSSFENV-RLSALGWGAIDFGAPSSNELLQ--TTLTVVSSTSCGTQLSRTILASQMCT 332

  Fly   190 GFQNGNIC-TETGSSLV-----KQIHYSGKLWNTLIGIQSYGVSERC------IYNKIAHYIDWI 242
            .....:.| .::|..|.     .|:.||       ||:..:||:  |      :..::..|:|||
Mosquito   333 FAAGNDTCQNDSGGPLYYTDPNSQLVYS-------IGVVGFGVA--CASSFPSVNTRVTSYLDWI 388

  Fly   243  242
            Mosquito   389  388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 49/230 (21%)
Tryp_SPc 39..242 CDD:304450 49/230 (21%)
AgaP_AGAP011913XP_001689277.1 CUB 35..144 CDD:238001 1/2 (50%)
Tryp_SPc 159..391 CDD:238113 51/242 (21%)
Tryp_SPc 159..388 CDD:214473 49/240 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.