DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and AgaP_AGAP006488

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_001688886.1 Gene:AgaP_AGAP006488 / 5667298 VectorBaseID:AGAP006488 Length:260 Species:Anopheles gambiae


Alignment Length:237 Identity:48/237 - (20%)
Similarity:98/237 - (41%) Gaps:57/237 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FKETPWMAFIASPT-KNCSGTLINKQYVITTASCVFDQSESTVF-------LGRFDNIPQ----N 89
            |.|.|.:.|:::|. :.|.||:||..:|:|:.:||.....:.::       :|...::|.    .
Mosquito    31 FGEYPSVVFVSTPRHQRCMGTVINANHVLTSGTCVMTDGAARIYPALLVQVVGGDLSVPNPVVTQ 95

  Fly    90 RNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNRWGL 154
            :.|..:|    ::.|:.:..:|.::::|::.|.:|.                    ||.||  |:
Mosquito    96 QTRVAQH----IFVHEHFRPRTNDNNVAIIRLAEPF--------------------HLPSN--GI 134

  Fly   155 SEKMIFQRI-------NTVK-ILKIKKCRDSFGITLKKSQICAGF------QNGNICTE---TGS 202
            .|..|..||       :.|: .|.......::.:.::...:|...      :..|||||   ...
Mosquito   135 EEAHIRMRIVPQGHQCDVVRTTLTGSPVLQAYNVQIRNRNLCDSCCLDIFREESNICTEPITISD 199

  Fly   203 SLVK--QIHYSGKLWNTLIGIQSYGVSERCIYNKIAHYIDWI 242
            ||::  .:...|:|......:.|...:....:|::..:..||
Mosquito   200 SLLQGDSMFCDGELTAIAATVVSNDQTREFHFNQVRFFTHWI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 45/233 (19%)
Tryp_SPc 39..242 CDD:304450 45/233 (19%)
AgaP_AGAP006488XP_001688886.1 Tryp_SPc 32..222 CDD:304450 43/215 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.