DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and PRTN3

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:255 Identity:57/255 - (22%)
Similarity:96/255 - (37%) Gaps:73/255 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KPHQDVFKETPWMAFI---ASPTKN-CSGTLINKQYVITTASCVFD--QSESTVFLGRFDNIPQN 89
            :||     ..|:||.:   .:|..: |.||||:..:|:|.|.|:.|  |....|.||. .|:...
Human    35 QPH-----SRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGA-HNVRTQ 93

  Fly    90 RNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSI---------QPI-----CIWLGE 140
            .......||..|:.:. |:.:...:|:.|:.|..|.....|:         ||:     |:.:| 
Human    94 EPTQQHFSVAQVFLNN-YDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMG- 156

  Fly   141 ITNLNHLESNRWGL-----SEKMIFQRINTVKILKIKKCRD----SFGITLKKSQICAGFQNGNI 196
                       ||.     ....:.|.:|...:...  ||.    :| :..:|:.||.|...|.:
Human   157 -----------WGRVGAHDPPAQVLQELNVTVVTFF--CRPHNICTF-VPRRKAGICFGDSGGPL 207

  Fly   197 CTETGSSLVKQIHYSGKLWNTLIGIQSY---GVSERC---IYNKIAHYIDWIVGVVLNVD 250
            ..:                ..:.||.|:   |.:.|.   .:.::|.|:|||...:..|:
Human   208 ICD----------------GIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 52/237 (22%)
Tryp_SPc 39..242 CDD:304450 52/237 (22%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 56/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.