DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and MASP1

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_011511291.1 Gene:MASP1 / 5648 HGNCID:6901 Length:735 Species:Homo sapiens


Alignment Length:262 Identity:63/262 - (24%)
Similarity:109/262 - (41%) Gaps:72/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFI----ASPTKN----CSGTLINKQYVITTASCVFDQSES-----------TVFLGRFDNI 86
            ||.|.|    .|...|    .||.|::..:::|.|..:..|...           ||:||..|  
Human   469 PWQALIVVEDTSRVPNDKWFGSGALLSASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHD-- 531

  Fly    87 PQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI-----------WLGE 140
            .::::..|..|...|..|..:|.|.:.|||||:.|.:||.....:.|:|:           .||.
Human   532 VRDKSGAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGL 596

  Fly   141 ITNLNHLESNRWGLS------EKMIFQRINTVK-ILKIKK--------CRDSF-----GITLKKS 185
            :..        ||:|      :::|.....|:. :|:..|        |:.|:     ..::.::
Human   597 VAG--------WGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTEN 653

  Fly   186 QICAGFQNGNICT---ETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYID 240
            ..|||:..|...|   ::|.:.|.....|.: | .:.|:.|:|..|.|       :|.|:::|:|
Human   654 MFCAGYYEGGKDTCLGDSGGAFVIFDDLSQR-W-VVQGLVSWGGPEECGSKQVYGVYTKVSNYVD 716

  Fly   241 WI 242
            |:
Human   717 WV 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 62/260 (24%)
Tryp_SPc 39..242 CDD:304450 62/260 (24%)
MASP1XP_011511291.1 CUB 35..144 CDD:238001
FXa_inhibition 160..188 CDD:291342
CUB 192..301 CDD:278839
Sushi 308..369 CDD:278512
CCP 374..439 CDD:153056
Tryp_SPc 456..718 CDD:214473 62/260 (24%)
Tryp_SPc 457..718 CDD:238113 62/260 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.