DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and zgc:112038

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:278 Identity:70/278 - (25%)
Similarity:111/278 - (39%) Gaps:70/278 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AGSLCFLFTLVLAHQGSAYFLDFECVNHKPHQDVFKETPWMAFI--ASPTKN-CSGTLINKQYVI 64
            ||:||.|.....|...:         |:.....|....||.|.|  .||..: |.|:||||.:|:
Zfish    18 AGALCQLDVCGQAPLNN---------NNGGDDAVAGSWPWQASIHRISPEDHICGGSLINKDWVL 73

  Fly    65 TTASC--VFDQSESTVFLGRFDNIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTF 127
            :.|.|  :...:...:||||......|.|. :..::..:..|..|:..|..:|||||.|...|||
Zfish    74 SAAHCFMITATANIKIFLGRQFQTGSNPNE-ISRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTF 137

  Fly   128 KMSIQPICI-------------WLG----------EITNLNHLESNRWGLSEKMIFQRINTVKIL 169
            ...|:|:|:             |:.          ::||               :.|.:. :.::
Zfish   138 TDYIRPVCLASADSVFAGGTKSWITGWDKHRSSDIQVTN---------------VLQEVQ-LPVV 186

  Fly   170 KIKKCRDSFGITLKKSQICAGFQNG--NICT-ETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC- 230
            ...:|...:...:..:.||||...|  :.|. ::|..:|.|   :|..| ...||.|:|  ..| 
Zfish   187 SNTECNADYKGIITDNMICAGINEGGKDACQGDSGGPMVSQ---NGSRW-IQSGIVSFG--RECG 245

  Fly   231 ------IYNKIAHYIDWI 242
                  ||.:::.|..||
Zfish   246 LPRYPGIYTRVSQYQSWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 60/240 (25%)
Tryp_SPc 39..242 CDD:304450 60/240 (25%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 61/248 (25%)
Tryp_SPc 37..263 CDD:238113 61/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.