DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and LOC548809

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001016055.2 Gene:LOC548809 / 548809 -ID:- Length:334 Species:Xenopus tropicalis


Alignment Length:244 Identity:58/244 - (23%)
Similarity:97/244 - (39%) Gaps:60/244 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIASPTKN-CSGTLINKQYVITTASCVFDQSES----TVFLGRFDNIPQNRNRYVKHSVQS 100
            ||...:.....: |.|::|:.|:::|.|.| |:.|.:    .|.||.:.....:.:..:. ||..
 Frog    70 PWQISLRYKGSHICGGSVISNQWIMTAAHC-FEYSRTPSDYQVLLGAYQLSVASASELLS-SVAR 132

  Fly   101 VYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI-------------WLGEITNLNHLESNRW 152
            |..:..:.......|||||.|..||.:...|.|:|:             |:           ..|
 Frog   133 VIVNPSFTIPGGPGDIALLKLTSPVAYTEYILPVCVPSSASGFYEGMQCWV-----------TGW 186

  Fly   153 G-------LSEKMIFQRINTVKILKIKKCRDSF----GIT-----LKKSQICAGFQNG--NICT- 198
            |       |......|::.| .::....|...:    ||:     :.|.|||||:..|  :.|. 
 Frog   187 GNIGSAVTLPYPQTLQQVMT-PLISWSTCNQMYHVQSGISSNIAIVPKDQICAGYAAGQKDSCQG 250

  Fly   199 ETGSSLVKQIHYSGKLWNTLIGIQSYG-----VSERCIYNKIAHYIDWI 242
            ::|..||.|:.   .:|.. |||.|:|     .|...:|..:.::..|:
 Frog   251 DSGGPLVCQLQ---GVWYQ-IGIVSWGDGCAQASRPGVYTLVPNFKSWL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 57/242 (24%)
Tryp_SPc 39..242 CDD:304450 57/242 (24%)
LOC548809NP_001016055.2 Tryp_SPc 57..294 CDD:214473 57/241 (24%)
Tryp_SPc 58..297 CDD:238113 58/244 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.