DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and Gzmbl1

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_038949997.1 Gene:Gzmbl1 / 502004 RGDID:1561819 Length:277 Species:Rattus norvegicus


Alignment Length:236 Identity:57/236 - (24%)
Similarity:89/236 - (37%) Gaps:61/236 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIA-----SPTKNCSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHSVQS 100
            |:||::.     |..|.|.|.||.|.:|:|.|.|:  .|:..|.||. .||.:...:.....|..
  Rat    62 PYMAYLQIMDKDSGNKTCGGFLIRKDFVLTAAHCL--GSKIIVTLGA-HNIKEQEKKQQVIPVVK 123

  Fly   101 VYTHKLYNKQTFEHDIALLLLDDPV--------------TFKMSIQPICIWLGEITNLNHLESNR 151
            :..|..||.:|..:||.||.|....              .||:....:|...|            
  Rat   124 IIPHPAYNAKTISNDIMLLKLKSKAKRTSAVKTLNLPRSNFKVKPGDVCYVAG------------ 176

  Fly   152 WGLSEKM-----IFQRINTVKILKIKKCRDSF-GITLKKSQICAGFQNGNICTETGSSLVKQIHY 210
            ||....|     ..|.:. :.:.:.:||.... .:..|.::||||..|           :|:..:
  Rat   177 WGKLGPMGEFPDTLQEVE-LTVQEDQKCESHLTNVYDKANEICAGDPN-----------IKRASF 229

  Fly   211 SGKLWNTLI------GIQSYGVSERCI---YNKIAHYIDWI 242
            .|.....|:      ||.|||..:...   :.|::.::.||
  Rat   230 QGDSGGPLVCKKVAAGIVSYGRKDGSTPREFTKVSTFLSWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 55/234 (24%)
Tryp_SPc 39..242 CDD:304450 55/234 (24%)
Gzmbl1XP_038949997.1 Tryp_SPc 50..273 CDD:238113 57/236 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.