DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and AgaP_AGAP011430

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_001237985.1 Gene:AgaP_AGAP011430 / 4577519 VectorBaseID:AGAP011430 Length:261 Species:Anopheles gambiae


Alignment Length:168 Identity:39/168 - (23%)
Similarity:65/168 - (38%) Gaps:55/168 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VFKETPWMAFIASPTKNCSGTLINKQYVITTASCV----------FDQSESTVFLGRFDNIPQNR 90
            ::|||      .:....|.|:||:.|:|||:|.||          :|:...|:         ||.
Mosquito    98 LWKET------QTDIYQCGGSLIDYQFVITSADCVDYGGPVMTKYYDEQFKTL---------QND 147

  Fly    91 NRYVKHSVQSVY-----THKLYNKQTFEHDIAL----------LLLDDPVTFKMSIQPI--CIWL 138
            :..:.|.....|     ...|:::  |:|.:.:          .|....:..|..:...  |.|.
Mosquito   148 SIRMLHDYTGFYGVFGGFRALHDE--FQHMVVIGWTRASSKIDYLCGGTLISKQFVLTAVHCAWD 210

  Fly   139 GEITNLNHLESNRWGLS--------EKMIFQRINTVKI 168
            |:  ||.. |:.|.|.:        |...|.|||:|::
Mosquito   211 GD--NLRP-ETRRLGDTDLGSTEDDEFATFGRINSVRL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 38/165 (23%)
Tryp_SPc 39..242 CDD:304450 38/165 (23%)
AgaP_AGAP011430XP_001237985.1 Tryp_SPc <2..57 CDD:304450
Tryp_SPc 161..>233 CDD:304450 13/76 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.