DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and AgaP_AGAP005592

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_001237685.2 Gene:AgaP_AGAP005592 / 4576199 VectorBaseID:AGAP005592 Length:299 Species:Anopheles gambiae


Alignment Length:239 Identity:63/239 - (26%)
Similarity:111/239 - (46%) Gaps:34/239 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 HQDVFKETPWMAFIASPTKNCSGTLINKQYVITTASCVF------DQSESTVFLGRFDNIPQNRN 91
            |.:|..:...::::.|    |:|:||..:||:|||:|::      |...:.|.||...|......
Mosquito    73 HAEVLIKPKSLSYLHS----CAGSLITLKYVLTTAACLYRWVNENDIEYAFVTLGSLFNGDTQWE 133

  Fly    92 RYVKHSVQSVYTHKLYNKQTFE-HDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNRWGLS 155
            :.:..:...::||.||:|..:| ::||.:.||.|.|....:||  |.|..:|::...|......|
Mosquito   134 QRINFTDDGIHTHPLYSKPNYEFNNIATIHLDCPATLNRFVQP--IRLPRLTDMRTYEMMEGTAS 196

  Fly   156 EKMIFQRINTVK--ILKIKKC-RDSFGITLKKSQ-ICAGFQNGNI-CT-ETGSSLVKQIHYSGKL 214
            .......:..::  ::..:.| ||...:.:..:| ||.....|.: |. |.||||..: ..:|::
Mosquito   197 GAKFIGGLKYLRNQVMSNEDCQRDILPVFIITAQHICTNSLIGGVFCNREFGSSLTVE-DQNGRV 260

  Fly   215 WNTLIGIQSYGVSERCIYN------KIAHYIDWIVGVVLNVDVI 252
               |||...|  ...|..|      :::::.|||   .:|.|.|
Mosquito   261 ---LIGFADY--LFLCDSNYPTRHVRVSYFRDWI---QMNSDYI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 56/221 (25%)
Tryp_SPc 39..242 CDD:304450 56/221 (25%)
AgaP_AGAP005592XP_001237685.2 Tryp_SPc 62..292 CDD:238113 60/233 (26%)
Tryp_SPc 62..289 CDD:214473 58/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.