DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG11313

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:263 Identity:64/263 - (24%)
Similarity:113/263 - (42%) Gaps:67/263 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KPHQDVFKETPWMAFIASPTKN-------CSGTLINKQYVITTASCVFDQSES---------TVF 79
            |.::.|..|..||..:.....:       |:|:|||.:||:|.|.||...:.:         :|.
  Fly   118 KGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVR 182

  Fly    80 LGRFDN-----------IPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQP 133
            ||..:.           :|:.    |:.:|:.:..|:.:..:.|.:||||:.|...|.:..||:|
  Fly   183 LGEHNTSAVVDCLNGRCLPEP----VQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRP 243

  Fly   134 ICIWLGEITNLNHLESNR------WGLSEKMIFQRINTVKILKIK-------KCRDSFG--ITLK 183
            :|  |.....|.:.:|.:      ||   :.:....:.|| :|::       .||..:.  :.|.
  Fly   244 VC--LPSTVGLQNWQSGQAFTVAGWG---RTLTSESSPVK-MKLRVTYVEPGLCRRKYASIVVLG 302

  Fly   184 KSQICA-GFQNGNICT-ETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYI 239
            .|.:|| |...|:.|. ::|..|:.   :...:| .|.||.|:|::  |       :|..:..|.
  Fly   303 DSHLCAEGRSRGDSCDGDSGGPLMA---FHEGVW-VLGGIVSFGLN--CGSRFWPAVYTNVLSYE 361

  Fly   240 DWI 242
            .||
  Fly   362 TWI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 60/253 (24%)
Tryp_SPc 39..242 CDD:304450 60/253 (24%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 64/263 (24%)
Tryp_SPc 116..364 CDD:214473 62/261 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.