DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG9737

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:263 Identity:67/263 - (25%)
Similarity:111/263 - (42%) Gaps:67/263 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETPWMAFIA--SPTKNCSGTLINKQYVITTASCVFDQSEST--------VFLGRFD--------- 84
            |.||:|.:.  |....|||.||:.::::|.|.||  |.|..        |.||.|:         
  Fly   160 EFPWLALLVYNSNDYGCSGALIDDRHILTAAHCV--QGEGVRDRQGLKHVRLGEFNVKTEPDCIE 222

  Fly    85 --NIPQNRNRYVKHSVQSVYTHKLYNK-QTFEH-DIALLLLDDPVTFKMSIQPIC---------I 136
              |.....:..:..:.:.::.|..|.: ..::: |||::.|..||:|...:.|||         :
  Fly   223 EPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTL 287

  Fly   137 WLGEITNLNHLESNRWGLSEKMIFQR--INTVKILKIK------------KCRDSFGITLKKSQI 187
            ..|::.::     :.||.::  :|.:  ||....:|:|            |..:.||:.|...||
  Fly   288 AEGQMFSV-----SGWGRTD--LFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGVRLGPKQI 345

  Fly   188 CAG--FQNGNICTETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWIV 243
            |||  |.......::|..|: ........| ...|:.|||.:: |       :|..:|.|.|||.
  Fly   346 CAGGEFAKDTCAGDSGGPLM-YFDRQHSRW-VAYGVVSYGFTQ-CGMAGKPAVYTNVAEYTDWID 407

  Fly   244 GVV 246
            .||
  Fly   408 SVV 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 63/257 (25%)
Tryp_SPc 39..242 CDD:304450 63/257 (25%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 63/257 (25%)
Tryp_SPc 150..409 CDD:238113 65/260 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.