DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:233 Identity:49/233 - (21%)
Similarity:81/233 - (34%) Gaps:81/233 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CSGTLINKQYVITTASCVFDQSESTVFLG-RFDNIPQNRNRYVKHSVQS--VYTHKLYNKQTFEH 114
            |.|::|...:|:|.|.|....|..|:..| .....||     ..|.|.|  :..|..||.....:
  Fly    63 CGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQ-----YTHWVGSGDIIQHHHYNSGNLHN 122

  Fly   115 DIALLLLDDPVTF-----KMSI--------------------------QPICIWLG--EITNLNH 146
            ||:|:.... |.|     |:.:                          .|:..||.  ::..::.
  Fly   123 DISLIRTPH-VDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQ 186

  Fly   147 LESNR-WGLSEKMIFQRINTVKILKIKKCRDSFGITLKKSQICAGFQNGNICTETGSSLVKQIHY 210
            .:.:| |.|.:.||              |.::.|    ....|.|...|.:.|..|         
  Fly   187 SDCSRTWSLHDNMI--------------CINTDG----GKSTCGGDSGGPLVTHDG--------- 224

  Fly   211 SGKLWNTLIGIQSYGVSERC------IYNKIAHYIDWI 242
                 |.|:|:.|:|.:..|      :::::..|:|||
  Fly   225 -----NRLVGVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 47/231 (20%)
Tryp_SPc 39..242 CDD:304450 47/231 (20%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 49/233 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.