DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG11843

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:266 Identity:65/266 - (24%)
Similarity:111/266 - (41%) Gaps:67/266 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CVNHKP-----HQDVFKETPWMAFIA---SPTKN----CSGTLINKQYVITTASCVFDQSE---- 75
            |.::.|     |....:|.|.||.:.   .|:..    |.|.||::::|:|.|.|:  :||    
  Fly    61 CRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCL--ESERGEV 123

  Fly    76 STVFLGR--FDNIPQN---RNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPIC 135
            :.|.||.  ||::.::   |:    :.|.....|..|....|.|||.|:.|.:.|.|.:...|.|
  Fly   124 NVVRLGELDFDSLDEDAAPRD----YMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPAC 184

  Fly   136 IWLGEITNLNHLESNRW---GLSEKMIFQRINTVKILKIKKCRDSFG-------ITLKKSQICAG 190
            :...:..:.:...:..|   ||:.|      .:.::||:|..|  :|       :|.:..:...|
  Fly   185 LPFQDERSSDSFIAVGWGSTGLALK------PSAQLLKVKLQR--YGNWVCKKLLTRQVEEFPRG 241

  Fly   191 FQ-NGNICT-----------ETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIA 236
            |. |..:|.           ::|..|: ..|........::||.|.|:|  |       ||.::.
  Fly   242 FDGNNQLCVGSEMAQDTCNGDSGGPLL-MYHREYPCMYVVVGITSAGLS--CGSPGIPGIYTRVY 303

  Fly   237 HYIDWI 242
            .|:.||
  Fly   304 PYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 60/247 (24%)
Tryp_SPc 39..242 CDD:304450 60/247 (24%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 63/259 (24%)
Tryp_SPc 68..309 CDD:214473 61/257 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.