DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG11841

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:243 Identity:56/243 - (23%)
Similarity:95/243 - (39%) Gaps:47/243 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KETPWMAFIASPTKN------CSGTLINKQYVITTASCVFDQ--SESTVFLGRF-------DNIP 87
            ||.|:.|.:.....|      |.||||:.:.|:|.|.|.|.:  ..:.|.||..       |..|
  Fly    81 KEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEP 145

  Fly    88 QNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNRW 152
            ::      ..|.::..|..:......:||.::.||..|.|.....|.|:...:........:..|
  Fly   146 ED------FGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQHESFIAIGW 204

  Fly   153 GLSEKMIFQRINTVKILKIK------KCRDSFGITLK-------KSQICAGFQ-NGNICTETGSS 203
            |..:   |.:..:.|:||::      :|..|.....:       |||:|.|.: |.:.|......
  Fly   205 GQKK---FAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGG 266

  Fly   204 LVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWIVG 244
            .|...|........::||.|.|::  |       .|.::.::::||.|
  Fly   267 PVLAYHKDLACMYHVMGITSAGIT--CSTPDIPSAYTRVHYFLNWIKG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 52/238 (22%)
Tryp_SPc 39..242 CDD:304450 52/238 (22%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 54/240 (23%)
Tryp_SPc 72..310 CDD:214473 53/239 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.