DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG5909

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:248 Identity:57/248 - (22%)
Similarity:105/248 - (42%) Gaps:59/248 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIASPTKN-----CSGTLINKQYVITTASCVFDQSE-STVFLGRFD-------NIPQNRNR 92
            ||:|.:.....:     |.|:||::::::|.|.|:.||.| ..|.||..|       :.....||
  Fly   142 PWVALLKYKINDPRPFRCGGSLISERHILTAAHCIIDQPEVIAVRLGEHDLESEEDCHYLGGTNR 206

  Fly    93 -----YVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNR- 151
                 |.::.::.:..|..|......||:|::.||..|..|..|:|:|:.:.:  ....|:.:: 
  Fly   207 VCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLDRVVKEKSHIKPVCLPIDQ--KSQELDFDQS 269

  Fly   152 -----WGLSEK-----MIFQRINTVKILKIKKCRDSFGITLKKSQICAGFQNGNIC-TETGSSLV 205
                 ||.:||     .:.|.:.|.|  .:.:||..:    .|.::    .:.:|| |.||....
  Fly   270 FFVAGWGGTEKETVATKLQQALITRK--SLNECRQYY----NKGEV----SDNHICATGTGIKHT 324

  Fly   206 KQ------IHYSGKLWNTLIGIQSYGV----------SERCIYNKIAHYIDWI 242
            .|      :.:..:..||...:| |||          ::..::..:...:.||
  Fly   325 CQGDSGGPVFFKHRFKNTYRVVQ-YGVVSFGGRLCGQNQPGVFASVIDMLPWI 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 55/246 (22%)
Tryp_SPc 39..242 CDD:304450 55/246 (22%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 55/246 (22%)
Tryp_SPc 132..379 CDD:238113 57/248 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.