DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and grass

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:268 Identity:64/268 - (23%)
Similarity:107/268 - (39%) Gaps:56/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DFECVN------HKPHQDVFKETPWMAFI-----ASPTKNCSGTLINKQYVITTASCVFDQSES- 76
            :|:|.|      ...::......||||.:     ......|.|.:|:::|::|.|.||...... 
  Fly   108 NFDCGNFLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQNDL 172

  Fly    77 -TVFLGRF------DNIPQNRNR-----YVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKM 129
             .:.||..      |...|.|.:     .|...::....|:.|:.:...||||||.|:..|.|:.
  Fly   173 YEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQK 237

  Fly   130 SIQPICIWLGEITN--------LNHLESNRWGLSEK-----MIFQRINTVKILKIKKCRDSFGIT 181
            .|:|||:   .||:        ::......||.:|.     ::.|.  .|.:.....|..::...
  Fly   238 HIKPICL---PITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQA--NVPLQPRSACSQAYRRA 297

  Fly   182 LKKSQICAGFQNGNI---CT-ETGSSLVKQIHYSGKLWNTLI--GIQSYGV------SERCIYNK 234
            :..||:|.|  .|::   |. ::|..|.....|.|:....::  ||.|.||      |...:|..
  Fly   298 VPLSQLCVG--GGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTN 360

  Fly   235 IAHYIDWI 242
            :..|:.||
  Fly   361 VGEYVQWI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 59/245 (24%)
Tryp_SPc 39..242 CDD:304450 59/245 (24%)
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 61/255 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.