DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG7432

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:235 Identity:65/235 - (27%)
Similarity:112/235 - (47%) Gaps:39/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMA--FIASPTKN---CSGTLINKQYVITTASCVFDQSES-------TVFLGRFD-NIPQNRNR 92
            ||||  |:..|.:.   |.|:||..:|::|.|.|..|..:.       ||.||..| :.....:.
  Fly   487 PWMAAIFLHGPKRTEFWCGGSLIGTKYILTAAHCTRDSRQKPFAARQFTVRLGDIDLSTDAEPSD 551

  Fly    93 YVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLG-EITNLNHLESNR----- 151
            .|..:|:.|.||:.:::..|.:|||:|:||.||.....:.|:|:..| .:.....|...|     
  Fly   552 PVTFAVKEVRTHERFSRIGFYNDIAILVLDKPVRKSKYVIPVCLPKGIRMPPKERLPGRRATVVG 616

  Fly   152 WGLS----EKMIFQRINTVKILKIKKCRDSFGITLKKSQICAGFQNGNI--CT-ETGSSLVKQIH 209
            ||.:    ::...||...:.|.:.:.|..|:...:.::.||||:.:|.:  |. ::|..|:  :.
  Fly   617 WGTTYYGGKESTSQRQAELPIWRNEDCDRSYFQPINENFICAGYSDGGVDACQGDSGGPLM--MR 679

  Fly   210 YSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
            |... | ..:|:.|:|  .:|       :|.::..|:|||
  Fly   680 YDSH-W-VQLGVVSFG--NKCGEPGYPGVYTRVTEYLDWI 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 63/233 (27%)
Tryp_SPc 39..242 CDD:304450 63/233 (27%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 63/233 (27%)
Tryp_SPc 475..718 CDD:238113 65/235 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.