DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG5255

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:254 Identity:55/254 - (21%)
Similarity:107/254 - (42%) Gaps:77/254 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IASPTKNCSGTLINKQYVITTASCVFDQSESTVF--LGRFDNIPQNRNRYVKHSVQSVYTHKLYN 108
            |.|...:|.|.:|:::::||.|.|...: ::|.|  |....::.||.::|  :....:..|..|.
  Fly    50 IGSGAHSCGGAIIDERWIITAAHCTRGR-QATAFRVLTGTQDLHQNGSKY--YYPDRIVEHSNYA 111

  Fly   109 KQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNH--------LESNRWGLSE--KMIFQRI 163
            .:.:.:|||||.|::.:.|..:.||:        .|:|        |....||...  ..:..|:
  Fly   112 PRKYRNDIALLHLNESIVFDNATQPV--------ELDHEALVPGSRLLLTGWGTLSLGGDVPARL 168

  Fly   164 NTVKI--LKIKKCRDSFGITLKKSQICAGFQN------GNICT-----------ETGSSLVKQIH 209
            .::::  :..::||             |...|      |::||           ::|..||    
  Fly   169 QSLEVNYVPFEQCR-------------AAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV---- 216

  Fly   210 YSGKLWNTLIGIQSYGVSERC------IYNKIAHYIDWIVGVVLNVDVILLNSSDSGSD 262
            ::||    |:.:.::|:.  |      .:..|::|.|:|      ...:.|:.:||..|
  Fly   217 HNGK----LVALVNWGLP--CAKGYPDAHASISYYHDFI------RTHLSLSKTDSSED 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 50/232 (22%)
Tryp_SPc 39..242 CDD:304450 50/232 (22%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 50/232 (22%)
Tryp_SPc 30..252 CDD:238113 51/241 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.