DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and Sb

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster


Alignment Length:239 Identity:63/239 - (26%)
Similarity:105/239 - (43%) Gaps:39/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FKETPWMA-------FIASPTKNCSGTLINKQYVITTASCVFDQ--SESTVFLGRFD-NIPQNRN 91
            |...||..       |..|.|..|.|.|||:.::.|...||.|.  |:..:.:|.:| :..|.:.
  Fly   552 FGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLLISQIRIRVGEYDFSHVQEQL 616

  Fly    92 RYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNL---NHLESNRWG 153
            .|::..|.....|..|:..|:|:|:||:.|:.|:.|...:.|||  |.|..:|   .:.....||
  Fly   617 PYIERGVAKKVVHPKYSFLTYEYDLALVKLEQPLEFAPHVSPIC--LPETDSLLIGMNATVTGWG 679

  Fly   154 -LSE----KMIFQRINTVKILKIKKCRDSFGITLKKSQI-----CAGFQNG--NICTETGSSLVK 206
             |||    ..:.|.: :|.|:....|:..|....::..|     |||::.|  :.|.......::
  Fly   680 RLSEGGTLPSVLQEV-SVPIVSNDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQ 743

  Fly   207 QIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWIV 243
            .....|:.:  |.||.|:|:.  |       :..:|:.:..||:
  Fly   744 AKSQDGRFF--LAGIISWGIG--CAEANLPGVCTRISKFTPWIL 783

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 60/234 (26%)
Tryp_SPc 39..242 CDD:304450 60/234 (26%)
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 61/236 (26%)
Tryp_SPc 544..785 CDD:238113 63/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.