DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and ea

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:269 Identity:67/269 - (24%)
Similarity:110/269 - (40%) Gaps:77/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETPWMAFIASPTK-------NCSGTLINKQYVITTASCV------FDQSESTVFLGRFD------ 84
            |.||||.| ..||       :|.|:||:.:||||.:.||      .|...|.|.||.:|      
  Fly   138 EFPWMALI-EYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPD 201

  Fly    85 ----------------NIPQNRN----RYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKM 129
                            ::|..|.    .|:..|...|            :|||||.|...|.:..
  Fly   202 CEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQV------------NDIALLRLAQQVEYTD 254

  Fly   130 SIQPICIWLGEITNLNH-------LESNRWGLSEKMIFQRIN---TVKILKIKKCRDSFG---IT 181
            .::|||:.|.  .||..       ::...||.:|::....:.   .|:..::.:|::.:.   |.
  Fly   255 FVRPICLPLD--VNLRSATFDGITMDVAGWGKTEQLSASNLKLKAAVEGFRMDECQNVYSSQDIL 317

  Fly   182 LKKSQICAGFQNG-NICT-ETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAH 237
            |:.:|:|||.:.| :.|. ::|..|:.........:..|.|:.|:|.:. |       :|..:..
  Fly   318 LEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTP-CGLAGWPGVYTLVGK 381

  Fly   238 YIDWIVGVV 246
            |:|||...:
  Fly   382 YVDWIQNTI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 65/263 (25%)
Tryp_SPc 39..242 CDD:304450 65/263 (25%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 65/263 (25%)
Tryp_SPc 128..389 CDD:238113 67/266 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.