DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG9631

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster


Alignment Length:233 Identity:65/233 - (27%)
Similarity:106/233 - (45%) Gaps:39/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAF----IASPTKNCSGTLINKQYVITTASCVFDQSEST--VFLGRFDNIPQNRNRYVKHSVQ 99
            ||:|.    :.:.|..|..::|:|:.|||.|.|::.:|.|.  |:|||.|......|.....||.
  Fly   209 PWLAALYEGVGTATYKCVVSVISKRTVITAAHCIYGKSASQLWVYLGRHDRNENPENGASLVSVT 273

  Fly   100 SVYTHKLYNKQTF-EHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNR-----WGL---S 155
            ||.|...|..... :.|:.||:|..|:.:...|:|:|:| |....|...|.:.     ||.   :
  Fly   274 SVLTPSAYEGNPVPDADVGLLVLTSPMVYTKYIRPLCLW-GSNMGLPPNEGDTGAVAGWGYDRSA 337

  Fly   156 EKMIFQRINTVKI------LKIKKCRDSFGITLKKSQICAG--FQNGNICTETGSSLVKQIHYSG 212
            :|..|.:..:|::      ||..|..:.|   :.:..:|||  ..:|....::||:|   |....
  Fly   338 QKTRFPKTVSVRLVPRDQCLKEMKRAEDF---ITRRTVCAGNSESHGPCFGDSGSAL---IVLRN 396

  Fly   213 KLWNTLIGIQSYG--------VSERCIYNKIAHYIDWI 242
            ..| .:.|:.|..        :|:..||..:|.:|||:
  Fly   397 NRW-YVRGVVSLSPRHGEICDLSKYVIYCDVARHIDWV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 64/231 (28%)
Tryp_SPc 39..242 CDD:304450 64/231 (28%)
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 65/233 (28%)
Tryp_SPc 198..433 CDD:214473 64/231 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455938
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.