DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG31326

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:254 Identity:62/254 - (24%)
Similarity:94/254 - (37%) Gaps:73/254 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETPWMAFI------ASPTKNCSGTLINKQYVITTASCV------FDQSESTVFLGRFDNIPQNRN 91
            :.||:..|      ..|...|.||||:...|::.|.|.      ...|...|.||        ||
  Fly   284 QLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLG--------RN 340

  Fly    92 RYVKHS------VQSVYTHKLYN-KQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLES 149
            ....||      |..:..|:.:. ||..|.|:||:.||:||.:...|.|||:|         ..|
  Fly   341 TLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLW---------STS 396

  Fly   150 NR-------------WGLSE----KMIFQRINTVKILKIKKCR-DSFGITLKKSQICAGFQNGNI 196
            ||             ||..|    .....::..:.|:....|. :...:.::.|.:||.......
  Fly   397 NRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSSLCAKKTGAGP 461

  Fly   197 CTETGSS---LVKQIHYSGKLWNTLIGIQSYGV----------SERCIYNKIAHYIDWI 242
            |...|..   |.:|     .:| .|.|:.|.||          |:..::..:|.:|:|:
  Fly   462 CASDGGGPLMLREQ-----DVW-VLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWV 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 61/252 (24%)
Tryp_SPc 39..242 CDD:304450 61/252 (24%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 62/254 (24%)
Tryp_SPc 277..514 CDD:214473 61/252 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.