DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG11670

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:246 Identity:66/246 - (26%)
Similarity:111/246 - (45%) Gaps:47/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIASPTKN------CSGTLINKQYVITTASCV--FDQSESTVFLGRFD------NIPQNRN 91
            |.||.:....:|      |.|:||::::|:|.|.|:  ...|...|.:|...      |:...|.
  Fly   182 PHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKEWELNVAPQRR 246

  Fly    92 RYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIW------LGEITNLNHLESN 150
            |     |..:|.|.|||.....|||.|:.|:.||.:...::|:.:|      .|::..:.: .|.
  Fly   247 R-----VAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPVRLWPMNDIPYGKLHTMGY-GST 305

  Fly   151 RWGLSEKMIFQRINTVKILKIKKCRDSFGIT------LKKSQICAG--FQNGNICT-ETGSSLV- 205
            .:...:..|...:: :.::.|::|..|....      |..|||||.  .:|.:.|. ::|..|. 
  Fly   306 GFAQPQTNILTELD-LSVVPIEQCNSSLPADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQL 369

  Fly   206 -----KQIHYSGKLWN-TLIGIQSYGVSERC----IYNKIAHYIDWIVGVV 246
                 ::.|.|.|.:. .|:||.|||...|.    :|.:::.|||||..:|
  Fly   370 NLERRRRRHTSRKHYRYYLVGITSYGAYCRSELPGVYTRVSSYIDWIASIV 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 63/240 (26%)
Tryp_SPc 39..242 CDD:304450 63/240 (26%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 65/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455921
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.