DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and snk

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:215 Identity:59/215 - (27%)
Similarity:94/215 - (43%) Gaps:32/215 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CSGTLINKQYVITTASCVFDQSE--STVFLG-RFDNIPQNRNRYVKHSVQSVYTHKLYNKQTFEH 114
            |.|.|:::.||:|.|.|....|:  ..|.|| |..|......:.:|  :..:..|..|....:.|
  Fly   220 CGGALVSELYVLTAAHCATSGSKPPDMVRLGARQLNETSATQQDIK--ILIIVLHPKYRSSAYYH 282

  Fly   115 DIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNRWGLSEKM-----IFQRIN-------TVK 167
            |||||.|...|.|...::|.|:|......:..:.:..||.:|.:     ..::::       |.|
  Fly   283 DIALLKLTRRVKFSEQVRPACLWQLPELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCK 347

  Fly   168 ILKIKKCRDSFGITLKKSQICAGFQNGNICTETGSSLVKQIHYSGKLWNT---LIGIQSYGVSER 229
            .:..|:.|...||.  :.|.|||:..|...|..|.| ...||.....:|.   ::||.|:|  :.
  Fly   348 QIYRKERRLPRGII--EGQFCAGYLPGGRDTCQGDS-GGPIHALLPEYNCVAFVVGITSFG--KF 407

  Fly   230 C-------IYNKIAHYIDWI 242
            |       :|.::..|:|||
  Fly   408 CAAPNAPGVYTRLYSYLDWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 57/213 (27%)
Tryp_SPc 39..242 CDD:304450 57/213 (27%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 59/215 (27%)
Tryp_SPc 186..427 CDD:214473 57/213 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.