DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG11668

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:252 Identity:59/252 - (23%)
Similarity:104/252 - (41%) Gaps:65/252 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETPWMAFIASPTK-----------------NCSGTLINKQYVITTASC--VFDQSESTVFLGRFD 84
            |.|:|..:..|::                 ||...:|..::.||.|.|  |..:|.|...:|   
  Fly   158 EHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGESPSVALIG--- 219

  Fly    85 NIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPI-CIWLGE------IT 142
            .:..|..|.....::.:..|..::.:|..:|:|::.|     .:.|..|: |:|..|      :|
  Fly   220 GVELNSGRGQLIEIKRISQHPHFDAETLTNDLAVVKL-----ARRSHMPVACLWNQESLPERPLT 279

  Fly   143 NLNHLESNRWG-----LSEKMIFQRINTVKILKIKKCR------DSFGITLKKSQICAGFQNGNI 196
            .|.:.::...|     |.:.|::.       |..::|:      |.....|...|:|||..:||:
  Fly   280 ALGYGQTKFAGPHSSNLLQIMLYH-------LNFQQCQRYLHNYDKLANGLGSGQMCAGDYSGNM 337

  Fly   197 CTETGSS-----LVKQIHYSGKLWNTLIGIQSYGVSERC------IYNKIAHYIDWI 242
            .|..|.|     |.:.:.:.......::||.|:|.:  |      :|.:|||||.||
  Fly   338 DTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGA--CASGQPGVYVRIAHYIQWI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 57/250 (23%)
Tryp_SPc 39..242 CDD:304450 57/250 (23%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 59/252 (23%)
Tryp_SPc 149..392 CDD:214473 57/250 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455919
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.