DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG10041

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:293 Identity:63/293 - (21%)
Similarity:108/293 - (36%) Gaps:91/293 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLCFL--FTLVLAHQGSAYFLDFECVNHKPHQDVFKETPWMAFIASPTK---------------- 51
            |||.:  |..:.|.|        |.::..|.    ..||.:|...|.||                
  Fly     6 SLCSIAWFAAMSAAQ--------ETLSDTPQ----NSTPLLATTVSTTKVISFRPRYPYIVSIGE 58

  Fly    52 --------NCSGTLINKQYVITTASCVFDQSESTVFL-GRFDNIPQNRNRYVKHSVQSVYTHKLY 107
                    .|.|.:::.::|::.|.|:.......::: |..|::  |..:..:..|.....|..:
  Fly    59 NLKGYYKHLCVGVILSNEFVLSAAHCIQTNPTKQLYVAGGADSL--NSRKQTRFFVVERRWHPQF 121

  Fly   108 NKQTFEHDIALLL------LDDPVTFKMSIQPICIWLGEITNLNHLESN--RWGLSEKMIFQRIN 164
             :....:|||:|.      ||| |.|: ||.    :.|:....:..:::  .||        |:.
  Fly   122 -RVLGGNDIAVLRIYPKFPLDD-VRFR-SIN----FAGKPQRDSGTQASLVGWG--------RVG 171

  Fly   165 TVKILKIK----------KCRDSFG-ITLKKSQICAGFQNG--NICT-ETGSSLVKQIHYSGKLW 215
            ..||.|::          :|:.|.. :.||...|||....|  ..|. ::|:.|:....      
  Fly   172 VGKIRKLQEMPFLTMENDECQQSHRFVFLKPLDICAMHLKGPRGPCDGDSGAPLMNVAK------ 230

  Fly   216 NTLIGIQSYGVSERC------IYNKIAHYIDWI 242
            ..|.|:.||| .:.|      .:.:|..|..||
  Fly   231 EKLYGLLSYG-RKACTPLKPYAFTRINAYSSWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 53/255 (21%)
Tryp_SPc 39..242 CDD:304450 53/255 (21%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 49/238 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455949
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.