DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG16749

DIOPT Version :10

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:84 Identity:19/84 - (22%)
Similarity:33/84 - (39%) Gaps:18/84 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TGNSNITNEAD-------FQKTAQIV---------VASIQKILQNVSSMQRMVNQFGTAQDSPE- 58
            |.|.|.|.:|:       |:||...:         ....:||.|:|..:..:|.:...:.:..: 
  Fly    26 TSNENPTCDANDDGALEAFKKTCTPLTEGTFKGNAAVGCRKITQSVEGVLSVVRECAYSGEPVDG 90

  Fly    59 -LKQQLHQIRSYTQQLIND 76
             .|...|.||.:..|..|:
  Fly    91 LKKTGNHAIRIHYYQCENE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 8/40 (20%)
CG16749NP_649881.1 Tryp_SPc 30..259 CDD:238113 17/80 (21%)

Return to query results.
Submit another query.