DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG16749

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:233 Identity:55/233 - (23%)
Similarity:105/233 - (45%) Gaps:62/233 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ASPTKNCSGTLINKQYVITTASCVFDQ--SESTVFLGRFDNIPQNRNRYVKHSVQSVYTHKLYNK 109
            :|.:.:|.|::|:||:|:|.|.|...:  |:.:|..| ...|.......|:  |:.:..|:.||.
  Fly    50 SSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYG-VTKINATGPNVVR--VKKIIQHEDYNP 111

  Fly   110 -QTFEHDIALLLLDDPVTFK-MSIQPI-----------------CIWLGEITNLNHLESNRWGLS 155
             ..:.:||:|||:::|..|. :::.|:                 .:.:|            |||:
  Fly   112 YNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIG------------WGLN 164

  Fly   156 E-----KMIFQRINTVKILKIKKCRDSF-GITLKKSQICAGFQNG--NICT-ETGSSLVKQIHYS 211
            .     :...|.:. :|:...::|.:.. |.|..:..||.|...|  ..|: ::|..|:    |:
  Fly   165 ATGGYIQSTLQEVE-LKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGDSGGPLI----YN 224

  Fly   212 GKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
            |:    .:||.|:.: :.|       :|.|::.|:|||
  Fly   225 GQ----QVGIVSWSI-KPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 53/231 (23%)
Tryp_SPc 39..242 CDD:304450 53/231 (23%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 53/231 (23%)
Tryp_SPc 30..259 CDD:238113 55/233 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455947
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.