DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG9372

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:234 Identity:67/234 - (28%)
Similarity:111/234 - (47%) Gaps:30/234 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETPWMAFIAS---PTKNCSGTLINKQYVITTASCVFDQSESTVF--LGRFDNIPQNRNRYVKHSV 98
            |.||||.:..   |...|.|.||..::|:|.|.|::.:::..:|  ||.::....|..|.....:
  Fly   184 EWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHMLNETRARDFRI 248

  Fly    99 QSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI------WLGEITNLNHLESNRWGLSEK 157
            .::..|..||.|.:::|||::.:|....|...|.|:|:      |......:....:.::|....
  Fly   249 ANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSDRNAIVTGWGTQKFGGPHS 313

  Fly   158 MIFQRINTVKILKIKKCRDSFGITLKKSQICAGFQNG--NICT-ETGSSLVKQIHYSGKLWNTLI 219
            .|...:| :.:.|...||.||...:..:.:||||..|  :.|. ::|..|:.|:  ..:.|.| |
  Fly   314 NILMEVN-LPVWKQSDCRSSFVQHVPDTAMCAGFPEGGQDSCQGDSGGPLLVQL--PNQRWVT-I 374

  Fly   220 GIQSYGVSERC-------IYNKIAHYIDWIVGVVLNVDV 251
            ||.|:||.  |       ||.::..|:|||:.   |.||
  Fly   375 GIVSWGVG--CGQRGRPGIYTRVDRYLDWILA---NADV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 62/223 (28%)
Tryp_SPc 39..242 CDD:304450 62/223 (28%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 62/223 (28%)
Tryp_SPc 176..402 CDD:238113 62/223 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.