DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG33460

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:278 Identity:70/278 - (25%)
Similarity:111/278 - (39%) Gaps:61/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTAGSLCFLFTLVLAHQGSAYFLDFECVNHKPHQDVFKET------PWMAFI-ASPTKNCSGTLI 58
            :|...|.....::.:...||.:|..:|       .:.:|.      ||.|.: ...:..|:||||
  Fly     5 LTISLLASYMLVIYSDSVSANYLYEQC-------GLMREEFSTSLGPWTALLHTDGSIFCAGTLI 62

  Fly    59 NKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDD 123
            ...:::|.|||:...:.. |.||.|...|.....  .|.|.....::|:|.::..::|.||.|..
  Fly    63 TDVFILTAASCIRPNAVK-VRLGEFGRYPNELPE--DHLVHYFLMYRLFNNESLANNIGLLKLTK 124

  Fly   124 PVTFKMSIQPICIWLG----EITNLNHLESNRWGLSEKMIFQRINTVKIL-------KIKKCR-- 175
            .|.....|.|:||.|.    :::.:..: .|.|     |....::..|.|       |.|.|.  
  Fly   125 RVQITDYIMPVCIVLNPQNQQLSTMRFI-GNAW-----MEDSNVSLTKELRPIVIQSKPKMCTNL 183

  Fly   176 DSFGITLKKSQICAGFQNGNI--CTE-TGSSLVKQIHYSGKLWNTLIGI---------QSYGVSE 228
            |.:      :|.|||.| ||:  |.. |||:|::...|..|..:...||         :|.|   
  Fly   184 DLY------TQFCAGHQ-GNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVNDMDCEESQG--- 238

  Fly   229 RCIYNKIAHYIDWIVGVV 246
               |..:..:..||..||
  Fly   239 ---YTDVLKFYWWIQDVV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 60/234 (26%)
Tryp_SPc 39..242 CDD:304450 60/234 (26%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 61/229 (27%)
Tryp_SPc 44..249 CDD:214473 59/226 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.