DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and yip7

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:219 Identity:47/219 - (21%)
Similarity:83/219 - (37%) Gaps:51/219 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIA 117
            |.|::|..::|:|.|.|....:..|::.|..........:.|..|  ....|:.|...|..:||:
  Fly    68 CGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSS--KFRQHESYLALTIRNDIS 130

  Fly   118 LLLLDDPVTFKMSIQPICIWLGEITNLNHLESNR------WGLSEKMI------FQRINTVKILK 170
            |:.... |:|..::..|.  |..::|.......:      |||:....      .|.:: :.|:.
  Fly   131 LIQTSS-VSFSATVNKIS--LPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVD-LTIIS 191

  Fly   171 IKKCRDSFGI-----------TLKKSQICAGFQNGNICTETGSSLVKQIHYSGKLWNTLIGIQSY 224
            ..||:::||.           |..|:..|.|...|.:..:                ..|||..|:
  Fly   192 NSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALD----------------GVLIGATSF 240

  Fly   225 GVSERC------IYNKIAHYIDWI 242
            |.::.|      .:.:|.:|.|||
  Fly   241 GSADGCESGAPAAFTRITYYRDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 45/217 (21%)
Tryp_SPc 39..242 CDD:304450 45/217 (21%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 45/217 (21%)
Tryp_SPc 40..267 CDD:238113 47/219 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.