DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG3700

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:263 Identity:64/263 - (24%)
Similarity:106/263 - (40%) Gaps:70/263 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KETPWMAFIAS--PTK-------NCSGTLINKQYVITTASCV-------------FDQSESTVFL 80
            ||.|:||.|.:  |.|       :|.|::::.::|:|.|.|:             ||..:..|.|
  Fly   111 KEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRL 175

  Fly    81 GRFDNIPQNRNRYVK-HSVQSVYTHKLYN----KQTFEHDIALLLLDDPVTFKMSIQPICIWLGE 140
            |..|......:..|: ..|.:...|..|:    :|.|::||||:.||....|...:..:|:....
  Fly   176 GELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDS 240

  Fly   141 ITNLNHLESNRWGLSEKMIFQRINTVKILKIKKCRDSFGITLK--------KSQICAGFQNGNIC 197
            ..::..:.:..||.:.    ..:.:..:||:...|.|..:..|        ::|.|||..:....
  Fly   241 GNDVQQVTAAGWGFTA----DGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQAD 301

  Fly   198 TETGSS------------LVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWIV 243
            |..|.|            .:||:          |||.|||:.  |       :|.|:..|.|||.
  Fly   302 TCNGDSGGPIFVQHPLYPCLKQV----------IGIVSYGLV--CGSQGLPSVYTKVHLYTDWIE 354

  Fly   244 GVV 246
            .:|
  Fly   355 SIV 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 60/256 (23%)
Tryp_SPc 39..242 CDD:304450 60/256 (23%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 63/260 (24%)
Tryp_SPc 102..353 CDD:214473 61/257 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455918
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.