DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG30283

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:265 Identity:67/265 - (25%)
Similarity:117/265 - (44%) Gaps:31/265 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TLVLAHQGSAYFLDFECVNHKP---------HQDVFKETPWMAFIASPTK-NCSGTLINKQYVIT 65
            ::|:....|..||:..| ...|         |.......||||.:..... :|.||||..::|:|
  Fly    17 SVVVLGSESGSFLEHPC-GTVPISQFKILGGHNAPVASAPWMAMVMGEGGFHCGGTLITNRFVLT 80

  Fly    66 TASCVFDQSESTVFLGRFDNIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMS 130
            :|.|:.: .|..|.||    :.:......|.:|.:::.|..|...  :||:|||.|...|.:..:
  Fly    81 SAHCIAN-GELKVRLG----VLEREAEAQKFAVDAMFVHTDYYFD--QHDLALLRLAKRVHYSDN 138

  Fly   131 IQPICIWLGE-ITNLN-HLESNR---WGLSEKMIFQRI---NTVKILKIKKCRDSF-GITLKKSQ 186
            |.|||:.|.. :.|:: |:...|   ||.:|.....|:   .::..|...:|...: ...:.::.
  Fly   139 ISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHRSECAKQYPHQQINRNH 203

  Fly   187 ICAGFQNGNICT-ETGSSLVKQIHYSGKLWNTLIGIQSYG---VSERCIYNKIAHYIDWIVGVVL 247
            |||...|.|.|. ::|..|...:.|.........|:.|:|   .|:..::..:..::||||..|.
  Fly   204 ICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKATVFTNVMTHLDWIVNTVR 268

  Fly   248 NVDVI 252
            ..:::
  Fly   269 RAEIM 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 56/216 (26%)
Tryp_SPc 39..242 CDD:304450 56/216 (26%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 57/227 (25%)
Tryp_SPc 43..266 CDD:238113 60/229 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.