DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG10764

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:279 Identity:78/279 - (27%)
Similarity:131/279 - (46%) Gaps:29/279 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLCFLFTLVLAHQGSAYFLDFEC-VNHKPH----QDVFK-ETPWMAFIASPTK-NCSGTLINKQY 62
            :|..|.||.:.......||:..| ::.:|.    .|..: .:.|||.|.:.:. .|.||:|:.::
  Fly     8 ALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNSSDFQCGGTIIHMRF 72

  Fly    63 VITTASCVFDQSESTVFLG-RFDNIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVT 126
            |::.|.|:....:..|.|| |..|.|.     ..|:|.:|:.|..:....:.:||.||.|.:.:.
  Fly    73 VLSAAHCLVRGYDLYVRLGARNINEPA-----AVHTVINVFVHHDFIASEYRNDIGLLQLSESIV 132

  Fly   127 FKMSIQPICIWL-----GEITNLNHLESNRWGLSEKMIFQRINTVKILKIKK--CRDSFGITLKK 184
            :.:.:|||||:|     |.:..|....:..||.....:...:.|:.:|.:|:  |:......|..
  Fly   133 YTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRNGKLSIMLQTIYLLHLKRNECKRKLNFNLNS 197

  Fly   185 SQICAGFQNGNICT-ETGSSLVKQIHY-SGKLWNTLIGIQSYGVSERC----IYNKIAHYIDWIV 243
            .|||||.:||:.|. ::|..|...|.: |.|.:...:||.|:|..| |    :|..:..|:|||.
  Fly   198 RQICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPE-CRGVGVYTDVTSYVDWIS 261

  Fly   244 GVVLNVDVILLNSSDSGSD 262
            ..:...|.:.:..  ||.|
  Fly   262 STIARNDYLPIGV--SGGD 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 63/217 (29%)
Tryp_SPc 39..242 CDD:304450 63/217 (29%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 64/228 (28%)
Tryp_SPc 38..263 CDD:238113 66/230 (29%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.