DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG4927

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:250 Identity:58/250 - (23%)
Similarity:103/250 - (41%) Gaps:45/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KETPWMAFIASPTKN-------CSGTLINKQYVITTASCV-------------FDQSESTVFLGR 82
            :|.|:||.:....||       |...:|:.::|:|.|.|:             :|..:..|.||.
  Fly   114 REFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGE 178

  Fly    83 FD-NIPQNRNRYVKHSVQSVYTHKLYNKQ----TFEHDIALLLLDDPVTFKMSIQPICIWLGEIT 142
            .| |...:..:.....|.:...|..|.:.    :.::|||::.|:...||...:.|.|:.|....
  Fly   179 LDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLPLDGGN 243

  Fly   143 NLNHLESNRWGLSEKMIFQRINTVKI----LKIKKCRDSFGITLK-KSQICAGFQNGNICTETGS 202
            ....:.:..||.:.:......:.:|:    ..:.:|.......:. ::|:|||.::.:..|..|.
  Fly   244 EQLQVAAAGWGATSESGHASSHLLKVSLDRYDVAECSQRLEHKIDVRTQLCAGSRSTSADTCYGD 308

  Fly   203 S----LVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWIVGVV 246
            |    .|:...||  ....:|||.|||:.  |       :|.|:..|.|||..:|
  Fly   309 SGGPVFVQHPIYS--CLKQVIGITSYGLV--CGVQGLPSVYTKVHLYTDWIENIV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 55/243 (23%)
Tryp_SPc 39..242 CDD:304450 55/243 (23%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 57/247 (23%)
Tryp_SPc 105..355 CDD:214473 55/244 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455917
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.