DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and gammaTry

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster


Alignment Length:226 Identity:54/226 - (23%)
Similarity:96/226 - (42%) Gaps:41/226 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PW-MAFIASPTKNCSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRY-----VKHSVQ 99
            || ::...|.:.:|.|::.:...::|.|.|:...|.|.:.:       :..:.|     |..||.
  Fly    43 PWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQI-------RAGSSYWSSGGVTFSVS 100

  Fly   100 SVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNRWGL------SEKM 158
            |...|:.||..|..:|||::.::..:||..:|:.|.:......|......:.||.      |...
  Fly   101 SFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPS 165

  Fly   159 IFQRINTVKILKIKKCRDS---FGITLKKSQICAGFQNGNICT-ETGSSLVKQIHYSGKLWNTLI 219
            ..|.:| |.|:...:|..|   :|..::.:.|||.....:.|. ::|..||     ||   ..|:
  Fly   166 QLQYVN-VNIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLV-----SG---GVLV 221

  Fly   220 GIQSYGVSERC-------IYNKIAHYIDWIV 243
            |:.|:|..  |       :|..:|....|::
  Fly   222 GVVSWGYG--CAYSNYPGVYADVAALRSWVI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 53/223 (24%)
Tryp_SPc 39..242 CDD:304450 53/223 (24%)
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 53/223 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.