DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and thetaTry

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:247 Identity:61/247 - (24%)
Similarity:104/247 - (42%) Gaps:68/247 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IASPTKN----CSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHSVQSVYTHKL 106
            ::..||:    |.|:|||:..|:|.|.|:..:..|.||: |..:...|....|. :|:.:..::.
  Fly    50 VSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFV-RLGSTLYNEGGIVV-AVRELAYNED 112

  Fly   107 YNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLE-------------SNRWGLSEKM 158
            ||.:|.|:|:.:|.||:.|.             |..|:.::|             ...||  .|.
  Fly   113 YNSKTMEYDVGILKLDEKVK-------------ETENIRYIELATETPPTGTTAVVTGWG--SKC 162

  Fly   159 IF---------QRINTVKILKIKKCRD---SFGITLKKSQICAGFQNGNICT-ETGSSLVKQIHY 210
            .|         |.: .|.|:..|.|..   .:|..:..|.:||..:..:.|. ::|..|.     
  Fly   163 YFWCMTLPKTLQEV-YVNIVDWKTCASDEYKYGEIIYDSMVCAYEKKKDACQGDSGGPLA----- 221

  Fly   211 SGKLWNTLIGIQSYGVSERCIYNKIAHYIDWIVGVVLNVDVI---LLNSSDS 259
               :.|||:||.|:|.:  |..|.:.       ||..:|..:   :||:|::
  Fly   222 ---VGNTLVGIVSWGYA--CASNLLP-------GVYSDVPALRKWILNASET 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 55/225 (24%)
Tryp_SPc 39..242 CDD:304450 55/225 (24%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 58/239 (24%)
Tryp_SPc 35..255 CDD:238113 58/239 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.